3.03 Rating by CuteStat

megapowerservices.com is 5 years 3 days old. It is a domain having com extension. It has a global traffic rank of #1528851 in the world. This website is estimated worth of $ 720.00 and have a daily income of around $ 3.00. As no active threats were reported recently by users, megapowerservices.com is SAFE to browse.

PageSpeed Score
21
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 551
Daily Pageviews: 1,102

Estimated Valuation

Income Per Day: $ 3.00
Estimated Worth: $ 720.00

Search Engine Indexes

Google Indexed Pages: 97
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 3,600
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 1,528,851
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

116.206.105.47

Hosted Country:

Seychelles SC

Location Latitude:

-4.5833

Location Longitude:

55.6667

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 5 H2 Headings: 7
H3 Headings: Not Applicable H4 Headings: 54
H5 Headings: 2 H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 68
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 116.206.105.47)

Web Design|Best Optimization Company|Best Internet Marketing

- utkarshsoftech.com

UTKARSH SOFTECH is a leading IT company provides best affordable web design, software development, Search Engine Optimization services.

Not Applicable $ 8.95

Site Maintenance

- arthinfosoft.com
Not Applicable $ 8.95

403 Forbidden

- taolabs.in
Not Applicable $ 8.95

Bitsy.biz

- bitsy.biz
Not Applicable $ 8.95

Russian Escort in Delhi Call Book 9811190633 , Delhi Escort Agency

- russianescortindelhi.com

Are you looking for Russian escort in Delhi? Our Delhi escorts agency provides best escort service. Call me for russian escort in delhi -9811190633

7,238,052 $ 240.00

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sun, 29 Dec 2019 15:30:04 GMT
Server: Apache/2.4.39 (cPanel) OpenSSL/1.0.2r mod_bwlimited/1.4 Phusion_Passenger/5.3.7
X-Powered-By: PHP/7.3.7
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=utf-8

Domain Information

Domain Registrar: Nimzo 27, LLC
Registration Date: Apr 26, 2019, 3:51 PM 5 years 3 days 11 hours ago
Expiration Date: Apr 26, 2020, 3:51 PM 4 years 1 day 11 hours ago
Domain Status:
clienttransferprohibited

Domain Nameserver Information

Host IP Address Country
ns1.bh-in-32.webhostbox.net 116.206.105.47 Seychelles Seychelles
ns2.bh-in-32.webhostbox.net 116.206.105.47 Seychelles Seychelles

DNS Record Analysis

Host Type TTL Extra
megapowerservices.com A 10793 IP: 116.206.105.47
megapowerservices.com NS 86400 Target: ns2.bh-in-32.webhostbox.net
megapowerservices.com NS 86400 Target: ns1.bh-in-32.webhostbox.net
megapowerservices.com SOA 10800 MNAME: ns1.bh-in-32.webhostbox.net
RNAME: info.ideogram.in
Serial: 2019120601
Refresh: 3600
Retry: 1800
Expire: 1209600
Minimum TTL: 86400
megapowerservices.com MX 14400 Target: megapowerservices.com
megapowerservices.com TXT 14400 TXT: v=spf1 a mx include:webhostbox.net ~all

Similarly Ranked Websites

SILVER | SEABORNE - Seaborne Airlines

- seaborneairlines.com
1,528,852 $ 720.00

Красная Книга Архнадзора

- redbook.archnadzor.ru

Красная Книга Москвы – здания под угрозой

1,528,852 $ 720.00

Чёрная Книга

- blackbook.archnadzor.ru

Чёрная книга АрхНадзора: московские утраты новейшей эпохи

1,528,852 $ 720.00

Ñàìûé áûñòðûé òîððåíò òðåêåð ñ íîâèíêàìè ôèëüìîâ è ñåðèàëîâ Octopus

- octopusfilm.online

Ñàìûé áûñòðûé òîððåíò òðåêåð ñ íîâèíêàìè ôèëüìîâ è ñåðèàëîâ 2018 2019 ãîäà, êîòîðûå ìîæíî ñêà÷àòü èëè ñìîòðåòü îíëàéí â õîðîøåì êà÷åñòâå HD íà Octopus

1,528,852 $ 720.00

Index of /

- onlinemarketingreviewsandtips.com
1,528,854 $ 480.00

Full WHOIS Lookup

Domain Name: MEGAPOWERSERVICES.COM
Registry Domain ID: 2384535849_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: www.publicdomainregistry.com
Updated Date: 2019-06-26T02:19:43Z
Creation Date: 2019-04-26T10:06:46Z
Registrar Registration Expiration Date: 2020-04-26T10:06:46Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Rajesh Dogra
Registrant Organization: Mega Power Services
Registrant Street: Kunjwani
Registrant City: Jammu
Registrant State/Province: Jammu and Kashmir
Registrant Postal Code: 180010
Registrant Country: IN
Registrant Phone: +91.9906080444
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: megapower.jammu@gmail.com
Registry Admin ID: Not Available From Registry
Admin Name: Rajesh Dogra
Admin Organization: Mega Power Services
Admin Street: Kunjwani
Admin City: Jammu
Admin State/Province: Jammu and Kashmir
Admin Postal Code: 180010
Admin Country: IN
Admin Phone: +91.9906080444
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: megapower.jammu@gmail.com
Registry Tech ID: Not Available From Registry
Tech Name: Rajesh Dogra
Tech Organization: Mega Power Services
Tech Street: Kunjwani
Tech City: Jammu
Tech State/Province: Jammu and Kashmir
Tech Postal Code: 180010
Tech Country: IN
Tech Phone: +91.9906080444
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: megapower.jammu@gmail.com
Name Server: ns1.bh-in-32.webhostbox.net
Name Server: ns2.bh-in-32.webhostbox.net
DNSSEC: Unsigned
Registrar Abuse Contact Email: abuse-contact@publicdomainregistry.com
Registrar Abuse Contact Phone: +1.2013775952
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-29T15:30:39Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

Registration Service Provided By: IDEOGARM TECHNOLOGY SOLUTIONS PVT. LTD.

The data in this whois database is provided to you for information purposes
only, that is, to assist you in obtaining information about or related to a
domain name registration record. We make this information available "as is",
and do not guarantee its accuracy. By submitting a whois query, you agree
that you will use this data only for lawful purposes and that, under no
circumstances will you use this data to:
(1) enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or
(2) allow, enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic mail, or
by telephone.
The compilation, repackaging, dissemination or other use of this data is
expressly prohibited without prior written consent from us. The Registrar of
record is PDR Ltd. d/b/a PublicDomainRegistry.com.
We reserve the right to modify these terms at any time.
By submitting this query, you agree to abide by these terms.